PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_29716-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bHLH
Protein Properties Length: 227aa    MW: 25362.7 Da    PI: 6.16
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_29716-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH45.31.6e-1472124155
                      CHHHHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
              HLH   1 rrrahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55 
                      ++ +hn+ Er RR ++N+ +++Lr+l+P+a   + kKls  +++ ++ +YI +Lq
  TRIUR3_29716-P1  72 KKLSHNAYERDRRTQLNQLYSTLRSLIPNA--DHTKKLSIPTTVCQVLDYIPELQ 124
                      6789*************************7..35666***************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF474596.41E-1769139IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS5088813.72571123IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000836.90E-1171128No hitNo description
PfamPF000101.2E-1172124IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.109.1E-1472139IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003531.2E-877129IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 227 aa     Download sequence    Send to blast
MEHQQFDDAV PSSMIWPLEA DSGFTDELLS LQLPDLDLDF DIHEFSGPAT APAKAASSGG  60
SGLVGSGSGS HKKLSHNAYE RDRRTQLNQL YSTLRSLIPN ADHTKKLSIP TTVCQVLDYI  120
PELQKQVEDL EKKKQELTRA KCRERLQRVK DNTGRIVSAT PLDGNEIMVQ VSLLSNMAAS  180
LPLSKCINVF ENEGLHLISS STFSTEVNRT FYSFHFEMMF LKDNKKT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015695873.11e-69PREDICTED: transcription factor bHLH100-like
TrEMBLM8AKX91e-170M8AKX9_TRIUA; Transcription factor ORG2
STRINGOB01G53300.14e-69(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP32803472
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56970.13e-30bHLH family protein